Skip to main content

Advertisement

Table 1 Sequences and physico-chemical characteristics of Bet v 1-derived synthetic contiguous overlapping peptides (aa sequence refers to Bet v 1.01-A, SwissProt P15494.2)

From: Novel birch pollen specific immunotherapy formulation based on contiguous overlapping peptides

COP name Sequence pI Mw
T1: aa 2-50 GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGG 4.36 5295.93
T2: aa 48-118 NGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKIS 5.72 7742.76
T3: aa 106-160 VATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 6.29 6001.72
T4: aa 2-85 GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYS 5.24 9348.49
T5: aa 65-160 FKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSIL 5.77 6001.72
KISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN   
T6: aa 2-49 GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNG 4.36 5141.77
T7: aa 44-118 NIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKIS 5.24 8156.19
T8: aa 103-160 IKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN 7.03 6356.22
  1. aa : amino acids.